Lineage for d1q78a2 (1q78 A:19-214)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1051020Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1051021Superfamily d.218.1: Nucleotidyltransferase [81301] (14 families) (S)
  5. 1051199Family d.218.1.3: Poly(A) polymerase, PAP, N-terminal domain [81589] (1 protein)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543
  6. 1051200Protein Poly(A) polymerase, PAP, N-terminal domain [81588] (2 species)
  7. 1051210Species Cow (Bos taurus) [TaxId:9913] [81587] (3 PDB entries)
    Uniprot P25500 18-497
  8. 1051213Domain d1q78a2: 1q78 A:19-214 [104546]
    Other proteins in same PDB: d1q78a1, d1q78a3
    protein/RNA complex; complexed with 3at, mg

Details for d1q78a2

PDB Entry: 1q78 (more details), 2.8 Å

PDB Description: Crystal structure of poly(A) polymerase in complex with 3'-dATP and magnesium chloride
PDB Compounds: (A:) Poly(A) polymerase alpha

SCOPe Domain Sequences for d1q78a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q78a2 d.218.1.3 (A:19-214) Poly(A) polymerase, PAP, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
hygitspislaapketdclltqklvetlkpfgvfeeeeelqrrililgklnnlvkewire
isesknlpqsvienvggkiftfgsyrlgvhtkgadidalcvaprhvdrsdfftsfydklk
lqeevkdlraveeafvpviklcfdgieidilfarlalqtipedldlrddsllknldirci
rslngcrvtdeilhlv

SCOPe Domain Coordinates for d1q78a2:

Click to download the PDB-style file with coordinates for d1q78a2.
(The format of our PDB-style files is described here.)

Timeline for d1q78a2: