SCOP 1.69: Domain d1q78a1: 1q78 A:215-364

Lineage for d1q78a1 (1q78 A:215-364)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (3 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein)

6. Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56707] (3 PDB entries)

8. Domain d1q78a1: 1q78 A:215-364 [104545]
   Other proteins in same PDB: d1q78a2, d1q78a3

Details for d1q78a1

PDB Entry: 1q78, 2.8 Å

PDB Description: Crystal structure of poly(A) polymerase in complex with 3'-dATP and magnesium chloride

SCOP Domain Sequences for d1q78a1:

Sequence; same for both SEQRES and ATOM records:

>d1q78a1 a.160.1.1 (A:215-364) Poly(A) polymerase, PAP, middle domain {Cow (Bos taurus)}
pnidnfrltlraiklwakrhniysnilgflggvswamlvartcqlypnaiastlvhkffl
vfskwewpnpvllkqpeecnlnlpvwdprvnpsdryhlmpiitpaypqqnstynvsvstr
mvmveefkqglaitdeillskaewsklfea

Timeline for d1q78a1:

• d1q78a1 is new in SCOP 1.69
  
• d1q78a1 appears in SCOP 1.71
  
• d1q78a1 appears in the current release, SCOPe 2.08