![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
![]() | Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) ![]() this domain follows the catalytic nucleotidyltransferase domain |
![]() | Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein) |
![]() | Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56707] (3 PDB entries) Uniprot P25500 18-497 |
![]() | Domain d1q78a1: 1q78 A:215-364 [104545] Other proteins in same PDB: d1q78a2, d1q78a3 protein/RNA complex; complexed with 3at, mg |
PDB Entry: 1q78 (more details), 2.8 Å
SCOPe Domain Sequences for d1q78a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q78a1 a.160.1.1 (A:215-364) Poly(A) polymerase, PAP, middle domain {Cow (Bos taurus) [TaxId: 9913]} pnidnfrltlraiklwakrhniysnilgflggvswamlvartcqlypnaiastlvhkffl vfskwewpnpvllkqpeecnlnlpvwdprvnpsdryhlmpiitpaypqqnstynvsvstr mvmveefkqglaitdeillskaewsklfea
Timeline for d1q78a1: