Lineage for d1q78a1 (1q78 A:215-364)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735618Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 2735619Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 2735620Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein)
  6. 2735621Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species)
  7. 2735631Species Cow (Bos taurus) [TaxId:9913] [56707] (3 PDB entries)
    Uniprot P25500 18-497
  8. 2735634Domain d1q78a1: 1q78 A:215-364 [104545]
    Other proteins in same PDB: d1q78a2, d1q78a3
    protein/RNA complex; complexed with 3at, mg

Details for d1q78a1

PDB Entry: 1q78 (more details), 2.8 Å

PDB Description: Crystal structure of poly(A) polymerase in complex with 3'-dATP and magnesium chloride
PDB Compounds: (A:) Poly(A) polymerase alpha

SCOPe Domain Sequences for d1q78a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q78a1 a.160.1.1 (A:215-364) Poly(A) polymerase, PAP, middle domain {Cow (Bos taurus) [TaxId: 9913]}
pnidnfrltlraiklwakrhniysnilgflggvswamlvartcqlypnaiastlvhkffl
vfskwewpnpvllkqpeecnlnlpvwdprvnpsdryhlmpiitpaypqqnstynvsvstr
mvmveefkqglaitdeillskaewsklfea

SCOPe Domain Coordinates for d1q78a1:

Click to download the PDB-style file with coordinates for d1q78a1.
(The format of our PDB-style files is described here.)

Timeline for d1q78a1: