SCOPe 2.02: Domain d1q6xb2: 1q6x B:402-617

Lineage for d1q6xb2 (1q6x B:402-617)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families)

5. Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins)
   Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains

6. Protein Choline O-acetyltransferase [110591] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [110592] (2 PDB entries)
   Uniprot P32738

8. Domain d1q6xb2: 1q6x B:402-617 [104544]
   complexed with na

Details for d1q6xb2

PDB Entry: 1q6x, 2.5 Å

PDB Description: Crystal structure of rat choline acetyltransferase

PDB Compounds: (B:) choline O-acetyltransferase

SCOPe Domain Sequences for d1q6xb2:

Sequence; same for both SEQRES and ATOM records:

>d1q6xb2 c.43.1.3 (B:402-617) Choline O-acetyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfivykfdnygktfikkqkyspdgfiqvalqlayyrlyqrlvptyesasirrfqegrvdn
irsatpealafvqamtdhkaampaseklqllqtamqaqteytvmaitgmaidnhllalre
lardlckeppemfmdetylmsnrfvlstsqvpttmemfccygpvvpngygacynpqpeai
tfcissfhscketssvefaeavgaslvdmrdlcssr

Timeline for d1q6xb2:

• d1q6xb2 first appeared in SCOP 1.69
  
• d1q6xb2 appears in SCOPe 2.01
  
• d1q6xb2 appears in SCOPe 2.03
  
• d1q6xb2 appears in the current release, SCOPe 2.08