![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
![]() | Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families) ![]() |
![]() | Family c.43.1.3: Choline/Carnitine O-acyltransferase (Pfam 00755) [82424] (2 proteins) monomeric enzyme containing tandem repeat of two CAT subunit-like domains |
![]() | Protein Choline O-acetyltransferase [110591] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [110592] (1 PDB entry) |
![]() | Domain d1q6xb2: 1q6x B:402-617 [104544] |
PDB Entry: 1q6x (more details), 2.5 Å
SCOP Domain Sequences for d1q6xb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q6xb2 c.43.1.3 (B:402-617) Choline O-acetyltransferase {Rat (Rattus norvegicus)} dfivykfdnygktfikkqkyspdgfiqvalqlayyrlyqrlvptyesasirrfqegrvdn irsatpealafvqamtdhkaampaseklqllqtamqaqteytvmaitgmaidnhllalre lardlckeppemfmdetylmsnrfvlstsqvpttmemfccygpvvpngygacynpqpeai tfcissfhscketssvefaeavgaslvdmrdlcssr
Timeline for d1q6xb2: