Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) |
Family c.43.1.3: Choline/Carnitine O-acyltransferase [82424] (3 proteins) Pfam PF00755; monomeric enzyme containing tandem repeat of two CAT subunit-like domains |
Protein Choline O-acetyltransferase [110591] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [110592] (2 PDB entries) Uniprot P32738 |
Domain d1q6xa2: 1q6x A:402-617 [104542] complexed with na |
PDB Entry: 1q6x (more details), 2.5 Å
SCOPe Domain Sequences for d1q6xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q6xa2 c.43.1.3 (A:402-617) Choline O-acetyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]} dfivykfdnygktfikkqkyspdgfiqvalqlayyrlyqrlvptyesasirrfqegrvdn irsatpealafvqamtdhkaampaseklqllqtamqaqteytvmaitgmaidnhllalre lardlckeppemfmdetylmsnrfvlstsqvpttmemfccygpvvpngygacynpqpeai tfcissfhscketssvefaeavgaslvdmrdlcssr
Timeline for d1q6xa2: