Lineage for d1q6xa2 (1q6x A:402-617)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486085Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 486086Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families) (S)
  5. 486161Family c.43.1.3: Choline/Carnitine O-acyltransferase (Pfam 00755) [82424] (2 proteins)
    monomeric enzyme containing tandem repeat of two CAT subunit-like domains
  6. 486189Protein Choline O-acetyltransferase [110591] (1 species)
  7. 486190Species Rat (Rattus norvegicus) [TaxId:10116] [110592] (1 PDB entry)
  8. 486192Domain d1q6xa2: 1q6x A:402-617 [104542]

Details for d1q6xa2

PDB Entry: 1q6x (more details), 2.5 Å

PDB Description: Crystal structure of rat choline acetyltransferase

SCOP Domain Sequences for d1q6xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q6xa2 c.43.1.3 (A:402-617) Choline O-acetyltransferase {Rat (Rattus norvegicus)}
dfivykfdnygktfikkqkyspdgfiqvalqlayyrlyqrlvptyesasirrfqegrvdn
irsatpealafvqamtdhkaampaseklqllqtamqaqteytvmaitgmaidnhllalre
lardlckeppemfmdetylmsnrfvlstsqvpttmemfccygpvvpngygacynpqpeai
tfcissfhscketssvefaeavgaslvdmrdlcssr

SCOP Domain Coordinates for d1q6xa2:

Click to download the PDB-style file with coordinates for d1q6xa2.
(The format of our PDB-style files is described here.)

Timeline for d1q6xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q6xa1