Lineage for d1q5fa_ (1q5f A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501813Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 501814Superfamily d.24.1: Pili subunits [54523] (2 families) (S)
    bacterial filament proteins
  5. 501815Family d.24.1.1: Pilin [54524] (4 proteins)
  6. 501832Protein Type IVb pilin PilS [110866] (1 species)
  7. 501833Species Salmonella typhi [TaxId:90370] [110867] (1 PDB entry)
  8. 501834Domain d1q5fa_: 1q5f A: [104536]

Details for d1q5fa_

PDB Entry: 1q5f (more details)

PDB Description: nmr structure of type ivb pilin (pils) from salmonella typhi

SCOP Domain Sequences for d1q5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5fa_ d.24.1.1 (A:) Type IVb pilin PilS {Salmonella typhi}
mwgkkdagteltnyqtlatntigmmkgvdgyaftsgakmtdtliqagaakgmtvsgdpas
gsatlwnswggqivvapdtaggtgfnngftittnkvpqsacvsistgmsrsggtsgikin
gnnhtdakvtaeiassectadngrtgtntlvfnyng

SCOP Domain Coordinates for d1q5fa_:

Click to download the PDB-style file with coordinates for d1q5fa_.
(The format of our PDB-style files is described here.)

Timeline for d1q5fa_: