Lineage for d1q47b_ (1q47 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066460Superfamily b.69.12: Sema domain [101912] (1 family) (S)
    irregular 7-bladed beta-propeller with a large insertion in the fifth blade
    automatically mapped to Pfam PF01403
  5. 2066461Family b.69.12.1: Sema domain [101913] (3 protein domains)
    Pfam PF01403
  6. 2066465Protein Semaphorin 3a [110294] (1 species)
  7. 2066466Species Mouse (Mus musculus) [TaxId:10090] [110295] (1 PDB entry)
    Uniprot O08665 26-520
  8. 2066468Domain d1q47b_: 1q47 B: [104533]
    complexed with nag

Details for d1q47b_

PDB Entry: 1q47 (more details), 2.8 Å

PDB Description: structure of the semaphorin 3a receptor-binding module
PDB Compounds: (B:) Semaphorin 3A

SCOPe Domain Sequences for d1q47b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q47b_ b.69.12.1 (B:) Semaphorin 3a {Mouse (Mus musculus) [TaxId: 10090]}
knnvprlklsykemlesnnvitfnglansssyhtflldeersrlyvgakdhifsfnlvni
kdfqkivwpvsytrrdeckwagkdilkecanfikvleaynqthlyacgtgafhpictyie
vghhpednifklqdshfengrgkspydpklltasllidgelysgtaadfmgrdfaifrtl
ghhhpirteqhdsrwlndprfisahlipesdnpeddkvyfffrenaidgehsgkathari
gqickndfgghrslvnkwttflkarlicsvpgpngidthfdelqdvflmnskdpknpivy
gvfttssnifkgsavcmysmsdvrrvflgpyahrdgpnyqwvpyqgrvpyprpgtcpskt
fggfdstkdlpddvitfarshpamynpvfpinnrpimiktdvnyqftqivvdrvdaedgq
ydvmfigtdvgtvlkvvsvpketwhdleevlleemtvfrepttisamelstkqqqlyigs
tagvaqlplhrcdiy

SCOPe Domain Coordinates for d1q47b_:

Click to download the PDB-style file with coordinates for d1q47b_.
(The format of our PDB-style files is described here.)

Timeline for d1q47b_: