Lineage for d1q47a_ (1q47 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 469053Fold b.69: 7-bladed beta-propeller [50964] (13 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 469269Superfamily b.69.12: Sema domain [101912] (1 family) (S)
    irregular 7-bladed beta-propeller with a large insertion in the fifth blade
  5. 469270Family b.69.12.1: Sema domain [101913] (3 proteins)
    Pfam 01403
  6. 469274Protein Semaphorin 3a [110294] (1 species)
  7. 469275Species Mouse (Mus musculus) [TaxId:10090] [110295] (1 PDB entry)
  8. 469276Domain d1q47a_: 1q47 A: [104532]

Details for d1q47a_

PDB Entry: 1q47 (more details), 2.8 Å

PDB Description: structure of the semaphorin 3a receptor-binding module

SCOP Domain Sequences for d1q47a_:

Sequence, based on SEQRES records: (download)

>d1q47a_ b.69.12.1 (A:) Semaphorin 3a {Mouse (Mus musculus)}
knnvprlklsykemlesnnvitfnglansssyhtflldeersrlyvgakdhifsfnlvni
kdfqkivwpvsytrrdeckwagkdilkecanfikvleaynqthlyacgtgafhpictyie
vghhpednifklqdshfengrgkspydpklltasllidgelysgtaadfmgrdfaifrtl
ghhhpirteqhdsrwlndprfisahlipesdnpeddkvyfffrenaidgehsgkathari
gqickndfgghrslvnkwttflkarlicsvpgpngidthfdelqdvflmnskdpknpivy
gvfttssnifkgsavcmysmsdvrrvflgpyahrdgpnyqwvpyqgrvpyprpgtcpskt
fggfdstkdlpddvitfarshpamynpvfpinnrpimiktdvnyqftqivvdrvdaedgq
ydvmfigtdvgtvlkvvsvpketwhdleevlleemtvfrepttisamelstkqqqlyigs
tagvaqlplhrcdiy

Sequence, based on observed residues (ATOM records): (download)

>d1q47a_ b.69.12.1 (A:) Semaphorin 3a {Mouse (Mus musculus)}
knnvprlklsykemlesnnvitfnglansssyhtflldeersrlyvgakdhifsfnlvni
kdfqkivwpvsytrrdeckwagkdilkecanfikvleaynqthlyacgtgafhpictyie
vghhpednifklqdshfengrgkspydpklltasllidgelysgtaadfmgrdfaifrtl
ghhhpirteqhdsrwlndprfisahlipesdnpeddkvyfffrenaidgehsgkathari
gqickndfgghrslvnkwttflkarlicsvpgpngidthfdelqdvflmnskdpknpivy
gvfttssnifkgsavcmysmsdvrrvflgpyahrdgpnyqwvpyqgrvpyprpgtcpskt
fggfdstkdlpddvitfarshpamynpvfpinnrpimiktdvnyqftqivvdrvdaedgq
ydvmfigtdvgtvlkvvsvlleemtvfrepttisamelstkqqqlyigstagvaqlplhr
cdiy

SCOP Domain Coordinates for d1q47a_:

Click to download the PDB-style file with coordinates for d1q47a_.
(The format of our PDB-style files is described here.)

Timeline for d1q47a_:

Domains from other chains:
(mouse over for more information)
d1q47b_