Lineage for d1q3za_ (1q3z A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036238Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
    metal(zinc)-bound fold
  4. 3036239Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 3036240Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins)
  6. 3036244Protein HIV nucleocapsid [57760] (2 species)
    duplication: two similar zinc-binding motifs
  7. 3036245Species Human immunodeficiency virus type 1, different isolates [TaxId:11676] [57761] (12 PDB entries)
    Uniprot P03350 389-429
  8. 3036256Domain d1q3za_: 1q3z A: [104531]
    complexed with zn; mutant

Details for d1q3za_

PDB Entry: 1q3z (more details)

PDB Description: nmr structure of the cys28his mutant (e form) of the nucleocapsid protein ncp7 of hiv-1.
PDB Compounds: (A:) gag protein

SCOPe Domain Sequences for d1q3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3za_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]}
vkcfncgkeghtarnhraprkkgcwkcgkeghqmkdcterq

SCOPe Domain Coordinates for d1q3za_:

Click to download the PDB-style file with coordinates for d1q3za_.
(The format of our PDB-style files is described here.)

Timeline for d1q3za_: