![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins) |
![]() | Protein Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain [110241] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110242] (1 PDB entry) |
![]() | Domain d1q3xb1: 1q3x B:445-686 [104528] Other proteins in same PDB: d1q3xa2, d1q3xb2 |
PDB Entry: 1q3x (more details), 2.23 Å
SCOP Domain Sequences for d1q3xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3xb1 b.47.1.2 (B:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens)} iyggqkakpgdfpwqvlilggttaagallydnwvltaahavyeqkhdasaldirmgtlkr lsphytqawseavfihegythdagfdndialiklnnkvvinsnitpiclprkeaesfmrt ddigtasgwgltqrgflarnlmyvdipivdhqkctaayekppyprgsvtanmlcaglesg gkdscrgdsggalvfldseterwfvggivswgsmncgeagqygvytkvinyipwieniis df
Timeline for d1q3xb1: