Lineage for d1q3xb1 (1q3x B:445-686)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 465547Protein Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain [110241] (1 species)
  7. 465548Species Human (Homo sapiens) [TaxId:9606] [110242] (1 PDB entry)
  8. 465550Domain d1q3xb1: 1q3x B:445-686 [104528]
    Other proteins in same PDB: d1q3xa2, d1q3xb2

Details for d1q3xb1

PDB Entry: 1q3x (more details), 2.23 Å

PDB Description: Crystal structure of the catalytic region of human MASP-2

SCOP Domain Sequences for d1q3xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3xb1 b.47.1.2 (B:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens)}
iyggqkakpgdfpwqvlilggttaagallydnwvltaahavyeqkhdasaldirmgtlkr
lsphytqawseavfihegythdagfdndialiklnnkvvinsnitpiclprkeaesfmrt
ddigtasgwgltqrgflarnlmyvdipivdhqkctaayekppyprgsvtanmlcaglesg
gkdscrgdsggalvfldseterwfvggivswgsmncgeagqygvytkvinyipwieniis
df

SCOP Domain Coordinates for d1q3xb1:

Click to download the PDB-style file with coordinates for d1q3xb1.
(The format of our PDB-style files is described here.)

Timeline for d1q3xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q3xb2