Lineage for d1q3xa1 (1q3x A:445-686)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795686Protein Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain [110241] (1 species)
  7. 2795687Species Human (Homo sapiens) [TaxId:9606] [110242] (2 PDB entries)
    Uniprot O00187 366-686
  8. 2795688Domain d1q3xa1: 1q3x A:445-686 [104526]
    Other proteins in same PDB: d1q3xa2, d1q3xa3, d1q3xb2
    complexed with gol, na

Details for d1q3xa1

PDB Entry: 1q3x (more details), 2.23 Å

PDB Description: Crystal structure of the catalytic region of human MASP-2
PDB Compounds: (A:) Mannan-binding lectin serine protease 2

SCOPe Domain Sequences for d1q3xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iyggqkakpgdfpwqvlilggttaagallydnwvltaahavyeqkhdasaldirmgtlkr
lsphytqawseavfihegythdagfdndialiklnnkvvinsnitpiclprkeaesfmrt
ddigtasgwgltqrgflarnlmyvdipivdhqkctaayekppyprgsvtanmlcaglesg
gkdscrgdsggalvfldseterwfvggivswgsmncgeagqygvytkvinyipwieniis
df

SCOPe Domain Coordinates for d1q3xa1:

Click to download the PDB-style file with coordinates for d1q3xa1.
(The format of our PDB-style files is described here.)

Timeline for d1q3xa1: