Lineage for d1q3ta_ (1q3t A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865762Protein CMP kinase [52548] (3 species)
  7. 2865774Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [110525] (1 PDB entry)
    Uniprot Q97PK6
  8. 2865775Domain d1q3ta_: 1q3t A: [104525]

Details for d1q3ta_

PDB Entry: 1q3t (more details)

PDB Description: solution structure and function of an essential cmp kinase of streptococcus pneumoniae
PDB Compounds: (A:) Cytidylate kinase

SCOPe Domain Sequences for d1q3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mktiqiaidgpassgkstvakiiakdfgftyldtgamyraatymalknqlgveevealla
lldqhpisfgrsetgdqlvfvgdvdithpirenevtnhvsaiaaipevreklvslqqeia
qqggivmdgrdigtvvlpqaelkiflvasvderaerrykeniakgietdletlkkeiaar
dykdshretsplkqaedavyldttglniqevvekikaeaekrm

SCOPe Domain Coordinates for d1q3ta_:

Click to download the PDB-style file with coordinates for d1q3ta_.
(The format of our PDB-style files is described here.)

Timeline for d1q3ta_: