Lineage for d1q3ia1 (1q3i A:378-586)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564091Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 2564092Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 2564093Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. 2564161Protein Sodium/potassium-transporting ATPase alpha chain [90068] (3 species)
  7. 2564181Species Pig (Sus scrofa) [TaxId:9823] [111269] (2 PDB entries)
    Uniprot Q6PIE5 384-590
  8. 2564182Domain d1q3ia1: 1q3i A:378-586 [104524]
    Other proteins in same PDB: d1q3ia2
    complexed with ni

Details for d1q3ia1

PDB Entry: 1q3i (more details), 2.6 Å

PDB Description: crystal structure of na,k-atpase n-domain
PDB Compounds: (A:) Na,K-ATPase

SCOPe Domain Sequences for d1q3ia1:

Sequence, based on SEQRES records: (download)

>d1q3ia1 d.220.1.1 (A:378-586) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]}
mmtvahmwfdnqiheadttedqsgatfdkrsptwtalsriaglcnravfkagqenisvsk
rdtagdasesallkcielscgsvrkmrdrnpkvaeisfnstnkyqlsiherednpqshvl
vmkgaperildrcssilvqgkeipldkemqdafqnaylelgglgervlgfcqlnlpsgkf
prgfkfdtdelnfpteklcfvglmsmid

Sequence, based on observed residues (ATOM records): (download)

>d1q3ia1 d.220.1.1 (A:378-586) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]}
mmtvahmwfdnqiheadtttfdkrsptwtalsriaglcnravfkrdtagdasesallkci
elscgsvrkmrdrnpkvaeisyqlsiherednpqshvlvmkgaperildrcssilvqgke
ipldkemqdafqnaylelgglgervlgfcqlnlpsgkfprgfkfdtdelnfpteklcfvg
lmsmid

SCOPe Domain Coordinates for d1q3ia1:

Click to download the PDB-style file with coordinates for d1q3ia1.
(The format of our PDB-style files is described here.)

Timeline for d1q3ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q3ia2