![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily) unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432 |
![]() | Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) ![]() |
![]() | Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins) |
![]() | Protein Sodium/potassium-transporting ATPase alpha chain [90068] (3 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [111269] (2 PDB entries) Uniprot Q6PIE5 384-590 |
![]() | Domain d1q3ia1: 1q3i A:378-586 [104524] Other proteins in same PDB: d1q3ia2 complexed with ni has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1q3i (more details), 2.6 Å
SCOPe Domain Sequences for d1q3ia1:
Sequence, based on SEQRES records: (download)
>d1q3ia1 d.220.1.1 (A:378-586) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} mmtvahmwfdnqiheadttedqsgatfdkrsptwtalsriaglcnravfkagqenisvsk rdtagdasesallkcielscgsvrkmrdrnpkvaeisfnstnkyqlsiherednpqshvl vmkgaperildrcssilvqgkeipldkemqdafqnaylelgglgervlgfcqlnlpsgkf prgfkfdtdelnfpteklcfvglmsmid
>d1q3ia1 d.220.1.1 (A:378-586) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} mmtvahmwfdnqiheadtttfdkrsptwtalsriaglcnravfkrdtagdasesallkci elscgsvrkmrdrnpkvaeisyqlsiherednpqshvlvmkgaperildrcssilvqgke ipldkemqdafqnaylelgglgervlgfcqlnlpsgkfprgfkfdtdelnfpteklcfvg lmsmid
Timeline for d1q3ia1: