Lineage for d1q3ca3 (1q3c A:217-262)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892773Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 892802Protein Endonuclease VIII [82917] (1 species)
  7. 892803Species Escherichia coli [TaxId:562] [82918] (8 PDB entries)
    Uniprot P50465
  8. 892809Domain d1q3ca3: 1q3c A:217-262 [104523]
    Other proteins in same PDB: d1q3ca1, d1q3ca2
    complexed with gol, mg, zn; mutant

Details for d1q3ca3

PDB Entry: 1q3c (more details), 2.3 Å

PDB Description: crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli: the e2a mutant at 2.3 resolution.
PDB Compounds: (A:) Endonuclease VIII

SCOP Domain Sequences for d1q3ca3:

Sequence, based on SEQRES records: (download)

>d1q3ca3 g.39.1.8 (A:217-262) Endonuclease VIII {Escherichia coli [TaxId: 562]}
enkhhgalfrfkvfhrdgepcercgsiiekttlssrpfywcpgcqh

Sequence, based on observed residues (ATOM records): (download)

>d1q3ca3 g.39.1.8 (A:217-262) Endonuclease VIII {Escherichia coli [TaxId: 562]}
enkhhgalfrfkvfhrdgepcercgsiiektpfywcpgcqh

SCOP Domain Coordinates for d1q3ca3:

Click to download the PDB-style file with coordinates for d1q3ca3.
(The format of our PDB-style files is described here.)

Timeline for d1q3ca3: