Lineage for d1q3ca2 (1q3c A:2-124)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1334203Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 1334204Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
    automatically mapped to Pfam PF01149
  5. 1334205Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)
  6. 1334234Protein Endonuclease VIII [82233] (1 species)
  7. 1334235Species Escherichia coli [TaxId:562] [82234] (8 PDB entries)
    Uniprot P50465
  8. 1334241Domain d1q3ca2: 1q3c A:2-124 [104522]
    Other proteins in same PDB: d1q3ca1, d1q3ca3
    complexed with gol, mg, zn; mutant

Details for d1q3ca2

PDB Entry: 1q3c (more details), 2.3 Å

PDB Description: crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli: the e2a mutant at 2.3 resolution.
PDB Compounds: (A:) Endonuclease VIII

SCOPe Domain Sequences for d1q3ca2:

Sequence, based on SEQRES records: (download)

>d1q3ca2 b.113.1.1 (A:2-124) Endonuclease VIII {Escherichia coli [TaxId: 562]}
agpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsnd
ltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthpf
lqr

Sequence, based on observed residues (ATOM records): (download)

>d1q3ca2 b.113.1.1 (A:2-124) Endonuclease VIII {Escherichia coli [TaxId: 562]}
agpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsnd
ltlyshnqlygvwrvvdtgettrvlrvklqtadktillysasdiemlrpeqltthpflqr

SCOPe Domain Coordinates for d1q3ca2:

Click to download the PDB-style file with coordinates for d1q3ca2.
(The format of our PDB-style files is described here.)

Timeline for d1q3ca2: