Lineage for d1q3ca2 (1q3c A:2-124)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472160Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 472161Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 472162Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)
  6. 472188Protein Endonuclease VIII [82233] (1 species)
  7. 472189Species Escherichia coli [TaxId:562] [82234] (5 PDB entries)
  8. 472193Domain d1q3ca2: 1q3c A:2-124 [104522]
    Other proteins in same PDB: d1q3ca1, d1q3ca3

Details for d1q3ca2

PDB Entry: 1q3c (more details), 2.3 Å

PDB Description: crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli: the e2a mutant at 2.3 resolution.

SCOP Domain Sequences for d1q3ca2:

Sequence, based on SEQRES records: (download)

>d1q3ca2 b.113.1.1 (A:2-124) Endonuclease VIII {Escherichia coli}
agpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsnd
ltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthpf
lqr

Sequence, based on observed residues (ATOM records): (download)

>d1q3ca2 b.113.1.1 (A:2-124) Endonuclease VIII {Escherichia coli}
agpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsnd
ltlyshnqlygvwrvvdtgettrvlrvklqtadktillysasdiemlrpeqltthpflqr

SCOP Domain Coordinates for d1q3ca2:

Click to download the PDB-style file with coordinates for d1q3ca2.
(The format of our PDB-style files is described here.)

Timeline for d1q3ca2: