SCOPe 2.08: Domain d1q3ca2: 1q3c A:2-124

Lineage for d1q3ca2 (1q3c A:2-124)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families)
   automatically mapped to Pfam PF01149

5. Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)

6. Protein Endonuclease VIII [82233] (1 species)

7. Species Escherichia coli [TaxId:562] [82234] (8 PDB entries)
   Uniprot P50465

8. Domain d1q3ca2: 1q3c A:2-124 [104522]
   Other proteins in same PDB: d1q3ca1, d1q3ca3
   complexed with gol, mg, zn; mutant

Details for d1q3ca2

PDB Entry: 1q3c, 2.3 Å

PDB Description: crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli: the e2a mutant at 2.3 resolution.

PDB Compounds: (A:) Endonuclease VIII

SCOPe Domain Sequences for d1q3ca2:

Sequence, based on SEQRES records:

>d1q3ca2 b.113.1.1 (A:2-124) Endonuclease VIII {Escherichia coli [TaxId: 562]}
agpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsnd
ltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthpf
lqr

Sequence, based on observed residues (ATOM records):

>d1q3ca2 b.113.1.1 (A:2-124) Endonuclease VIII {Escherichia coli [TaxId: 562]}
agpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsnd
ltlyshnqlygvwrvvdtgettrvlrvklqtadktillysasdiemlrpeqltthpflqr

Timeline for d1q3ca2:

• d1q3ca2 first appeared in SCOP 1.69
  
• d1q3ca2 appears in SCOPe 2.07