Lineage for d1q3ca1 (1q3c A:125-213)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348330Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2348331Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2348406Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 2348449Protein Endonuclease VIII [81703] (1 species)
  7. 2348450Species Escherichia coli [TaxId:562] [81704] (8 PDB entries)
    Uniprot P50465
  8. 2348456Domain d1q3ca1: 1q3c A:125-213 [104521]
    Other proteins in same PDB: d1q3ca2, d1q3ca3
    complexed with gol, mg, zn; mutant

Details for d1q3ca1

PDB Entry: 1q3c (more details), 2.3 Å

PDB Description: crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli: the e2a mutant at 2.3 resolution.
PDB Compounds: (A:) Endonuclease VIII

SCOPe Domain Sequences for d1q3ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3ca1 a.156.1.2 (A:125-213) Endonuclease VIII {Escherichia coli [TaxId: 562]}
vgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgltgnh
kakdlnaaqldalahalleiprfsyatrg

SCOPe Domain Coordinates for d1q3ca1:

Click to download the PDB-style file with coordinates for d1q3ca1.
(The format of our PDB-style files is described here.)

Timeline for d1q3ca1: