Lineage for d1q3ba2 (1q3b A:1-124)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430477Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2430478Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) (S)
    automatically mapped to Pfam PF01149
  5. 2430479Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)
  6. 2430522Protein Endonuclease VIII [82233] (1 species)
  7. 2430523Species Escherichia coli [TaxId:562] [82234] (8 PDB entries)
    Uniprot P50465
  8. 2430528Domain d1q3ba2: 1q3b A:1-124 [104519]
    Other proteins in same PDB: d1q3ba1, d1q3ba3
    complexed with gol, mg, zn; mutant

Details for d1q3ba2

PDB Entry: 1q3b (more details), 2.05 Å

PDB Description: crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli: the r252a mutant at 2.05 resolution.
PDB Compounds: (A:) Endonuclease VIII

SCOPe Domain Sequences for d1q3ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3ba2 b.113.1.1 (A:1-124) Endonuclease VIII {Escherichia coli [TaxId: 562]}
pegpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn
dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp
flqr

SCOPe Domain Coordinates for d1q3ba2:

Click to download the PDB-style file with coordinates for d1q3ba2.
(The format of our PDB-style files is described here.)

Timeline for d1q3ba2: