Class b: All beta proteins [48724] (178 folds) |
Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) automatically mapped to Pfam PF01149 |
Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins) |
Protein Endonuclease VIII [82233] (1 species) |
Species Escherichia coli [TaxId:562] [82234] (8 PDB entries) Uniprot P50465 |
Domain d1q3ba2: 1q3b A:1-124 [104519] Other proteins in same PDB: d1q3ba1, d1q3ba3 complexed with gol, mg, zn; mutant |
PDB Entry: 1q3b (more details), 2.05 Å
SCOPe Domain Sequences for d1q3ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3ba2 b.113.1.1 (A:1-124) Endonuclease VIII {Escherichia coli [TaxId: 562]} pegpeirraadnleaaikgkpltdvwfafpqlktyqsqligqhvthvetrgkallthfsn dltlyshnqlygvwrvvdtgeepqttrvlrvklqtadktillysasdiemlrpeqltthp flqr
Timeline for d1q3ba2: