Lineage for d1q39a1 (1q39 A:125-213)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650278Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 650279Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 650319Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 650348Protein Endonuclease VIII [81703] (1 species)
  7. 650349Species Escherichia coli [TaxId:562] [81704] (5 PDB entries)
  8. 650354Domain d1q39a1: 1q39 A:125-213 [104515]
    Other proteins in same PDB: d1q39a2, d1q39a3
    complexed with ca, zn

Details for d1q39a1

PDB Entry: 1q39 (more details), 2.8 Å

PDB Description: Crystal structure of the DNA repair enzyme endonuclease-VIII (Nei) from E. coli: The WT enzyme at 2.8 resolution.
PDB Compounds: (A:) Endonuclease VIII

SCOP Domain Sequences for d1q39a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q39a1 a.156.1.2 (A:125-213) Endonuclease VIII {Escherichia coli [TaxId: 562]}
vgpdvldpnltpevvkerllsprfrnrqfagllldqaflaglgnylrveilwqvgltgnh
kakdlnaaqldalahalleiprfsyatrg

SCOP Domain Coordinates for d1q39a1:

Click to download the PDB-style file with coordinates for d1q39a1.
(The format of our PDB-style files is described here.)

Timeline for d1q39a1: