Lineage for d1q32c2 (1q32 C:302-538)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540800Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily)
    beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234
  4. 2540801Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) (S)
  5. 2540826Family d.136.1.3: Tyrosyl-DNA phosphodiesterase TDP1 [69815] (2 proteins)
  6. 2540827Protein Tyrosyl-DNA phosphodiesterase TDP1 [69816] (2 species)
  7. 2540828Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [111180] (1 PDB entry)
    Uniprot P38319 79-538
  8. 2540834Domain d1q32c2: 1q32 C:302-538 [104512]

Details for d1q32c2

PDB Entry: 1q32 (more details), 2.03 Å

PDB Description: Crystal Structure Analysis of the Yeast Tyrosyl-DNA Phosphodiesterase
PDB Compounds: (C:) tyrosyl-DNA phosphodiesterase

SCOPe Domain Sequences for d1q32c2:

Sequence, based on SEQRES records: (download)

>d1q32c2 d.136.1.3 (C:302-538) Tyrosyl-DNA phosphodiesterase TDP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
takhylcqtssigtslsrardenlwthlmiplftgimsppakdtagrkkaeilptnslin
eysqrkikpyiifpteqefvtsplkwsssgwfhfqylqkksyyemlrnkfkvfykqdpam
vtrrrgttpahskfymhcatnsagpcdasqvfkelewclytsanlsqtawgtvsrkprny
eagvlyhsrrlantrkvtcrtftrdrrgcagnpthvavpftlpvipydlaedecfcl

Sequence, based on observed residues (ATOM records): (download)

>d1q32c2 d.136.1.3 (C:302-538) Tyrosyl-DNA phosphodiesterase TDP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
takhylcqtssigtslsrardenlwthlmiplftgimspilptnslineysqrkikpyii
fpteqefvtsplkwsssgwfhfqylqkksyyemlrnkfkvfykqdpamvtrrrgttpahs
kfymhcatfkelewclytsanlsqtawgtvsrkprnyeagvlyhsrrlantrkvtcrtft
rdpthvavpftlpvipydlaedecfcl

SCOPe Domain Coordinates for d1q32c2:

Click to download the PDB-style file with coordinates for d1q32c2.
(The format of our PDB-style files is described here.)

Timeline for d1q32c2: