SCOPe 2.05: Domain d1q2xb2: 1q2x B:134-357

Lineage for d1q2xb2 (1q2x B:134-357)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)

7. Species Haemophilus influenzae [TaxId:727] [103103] (12 PDB entries)
   Uniprot P44801

8. Domain d1q2xb2: 1q2x B:134-357 [104506]
   Other proteins in same PDB: d1q2xa1, d1q2xb1
   mutant

Details for d1q2xb2

PDB Entry: 1q2x, 2.05 Å

PDB Description: crystal structure of the e243d mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with substrate aspartate semialdehyde

PDB Compounds: (B:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1q2xb2:

Sequence; same for both SEQRES and ATOM records:

>d1q2xb2 d.81.1.1 (B:134-357) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]}
gnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkd
passildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkdewkgyaetnk
ilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndke
itlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwg

Timeline for d1q2xb2:

• d1q2xb2 first appeared in SCOP 1.69
  
• d1q2xb2 appears in SCOPe 2.04
  
• d1q2xb2 appears in SCOPe 2.06
  
• d1q2xb2 appears in the current release, SCOPe 2.08