Lineage for d1q2xb2 (1q2x B:134-357)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727888Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 727889Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 727890Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 727897Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 727909Species Haemophilus influenzae [TaxId:727] [103103] (12 PDB entries)
  8. 727920Domain d1q2xb2: 1q2x B:134-357 [104506]
    Other proteins in same PDB: d1q2xa1, d1q2xb1
    complexed with hti; mutant

Details for d1q2xb2

PDB Entry: 1q2x (more details), 2.05 Å

PDB Description: crystal structure of the e243d mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with substrate aspartate semialdehyde
PDB Compounds: (B:) aspartate-semialdehyde dehydrogenase

SCOP Domain Sequences for d1q2xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2xb2 d.81.1.1 (B:134-357) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]}
gnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkd
passildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkdewkgyaetnk
ilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndke
itlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwg

SCOP Domain Coordinates for d1q2xb2:

Click to download the PDB-style file with coordinates for d1q2xb2.
(The format of our PDB-style files is described here.)

Timeline for d1q2xb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q2xb1