![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.1: GAPDH-like [55348] (4 proteins) has many additional secondary structures |
![]() | Protein Aspartate beta-semialdehyde dehydrogenase [55361] (3 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [103103] (12 PDB entries) |
![]() | Domain d1q2xb2: 1q2x B:134-357 [104506] Other proteins in same PDB: d1q2xa1, d1q2xb1 complexed with hti; mutant |
PDB Entry: 1q2x (more details), 2.05 Å
SCOP Domain Sequences for d1q2xb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q2xb2 d.81.1.1 (B:134-357) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae} gnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkd passildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkdewkgyaetnk ilglsdnpipvdglcvrigalrchsqaftiklkkdlpleeieqiiashnewvkvipndke itlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwg
Timeline for d1q2xb2: