Lineage for d1q2xa1 (1q2x A:1-133,A:358-371)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828665Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 1828677Species Haemophilus influenzae [TaxId:727] [102159] (12 PDB entries)
    Uniprot P44801
  8. 1828691Domain d1q2xa1: 1q2x A:1-133,A:358-371 [104503]
    Other proteins in same PDB: d1q2xa2, d1q2xb2
    mutant

Details for d1q2xa1

PDB Entry: 1q2x (more details), 2.05 Å

PDB Description: crystal structure of the e243d mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with substrate aspartate semialdehyde
PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1q2xa1:

Sequence, based on SEQRES records: (download)

>d1q2xa1 c.2.1.3 (A:1-133,A:358-371) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]}
mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
seglkkgiktfvgXaaepvrrilkqlva

Sequence, based on observed residues (ATOM records): (download)

>d1q2xa1 c.2.1.3 (A:1-133,A:358-371) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]}
mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqalksafdieelkkldiivtcq
ggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvgX
aaepvrrilkqlva

SCOPe Domain Coordinates for d1q2xa1:

Click to download the PDB-style file with coordinates for d1q2xa1.
(The format of our PDB-style files is described here.)

Timeline for d1q2xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q2xa2