Lineage for d1q2hb_ (1q2h B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993627Fold a.34: Dimerisation interlock [47405] (4 superfamilies)
    4 helices; bundle, closed, right-handed twist
  4. 1993662Superfamily a.34.4: Phenylalanine zipper [109805] (1 family) (S)
    interlocking dimer with longer helices and aromatic-rich core
    automatically mapped to Pfam PF08916
  5. 1993663Family a.34.4.1: Adapter protein APS, dimerisation domain [109806] (1 protein)
  6. 1993664Protein Adapter protein APS, dimerisation domain [109807] (1 species)
  7. 1993665Species Human (Homo sapiens) [TaxId:9606] [109808] (1 PDB entry)
    Uniprot O14492 21-85
  8. 1993667Domain d1q2hb_: 1q2h B: [104499]

Details for d1q2hb_

PDB Entry: 1q2h (more details), 1.7 Å

PDB Description: Phenylalanine Zipper Mediates APS Dimerization
PDB Compounds: (B:) adaptor protein with pleckstrin homology and src homology 2 domains

SCOPe Domain Sequences for d1q2hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2hb_ a.34.4.1 (B:) Adapter protein APS, dimerisation domain {Human (Homo sapiens) [TaxId: 9606]}
pdwrqfcelhaqaaavdfahkfcrflrdnpaydtpdagasfsrhfaanfldvfgeevrrv
lv

SCOPe Domain Coordinates for d1q2hb_:

Click to download the PDB-style file with coordinates for d1q2hb_.
(The format of our PDB-style files is described here.)

Timeline for d1q2hb_: