SCOPe 2.05: Domain d1q2ha_: 1q2h A:

Lineage for d1q2ha_ (1q2h A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.34: Dimerisation interlock [47405] (4 superfamilies)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.34.4: Phenylalanine zipper [109805] (1 family)
   interlocking dimer with longer helices and aromatic-rich core
   automatically mapped to Pfam PF08916

5. Family a.34.4.1: Adapter protein APS, dimerisation domain [109806] (1 protein)

6. Protein Adapter protein APS, dimerisation domain [109807] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109808] (1 PDB entry)
   Uniprot O14492 21-85

8. Domain d1q2ha_: 1q2h A: [104498]

Details for d1q2ha_

PDB Entry: 1q2h, 1.7 Å

PDB Description: phenylalanine zipper mediates aps dimerization

PDB Compounds: (A:) adaptor protein with pleckstrin homology and src homology 2 domains

SCOPe Domain Sequences for d1q2ha_:

Sequence; same for both SEQRES and ATOM records:

>d1q2ha_ a.34.4.1 (A:) Adapter protein APS, dimerisation domain {Human (Homo sapiens) [TaxId: 9606]}
pdwrqfcelhaqaaavdfahkfcrflrdnpaydtpdagasfsrhfaanfldvfgeevrrv
lva

Timeline for d1q2ha_:

• d1q2ha_ first appeared in SCOP 1.69
  
• d1q2ha_ appears in SCOPe 2.04
  
• d1q2ha_ appears in SCOPe 2.06
  
• d1q2ha_ appears in the current release, SCOPe 2.08