Lineage for d1q2ha_ (1q2h A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709270Fold a.34: Dimerisation interlock [47405] (4 superfamilies)
    4 helices; bundle, closed, right-handed twist
  4. 2709309Superfamily a.34.4: Phenylalanine zipper [109805] (1 family) (S)
    interlocking dimer with longer helices and aromatic-rich core
    automatically mapped to Pfam PF08916
  5. 2709310Family a.34.4.1: Adapter protein APS, dimerisation domain [109806] (1 protein)
  6. 2709311Protein Adapter protein APS, dimerisation domain [109807] (1 species)
  7. 2709312Species Human (Homo sapiens) [TaxId:9606] [109808] (1 PDB entry)
    Uniprot O14492 21-85
  8. 2709313Domain d1q2ha_: 1q2h A: [104498]

Details for d1q2ha_

PDB Entry: 1q2h (more details), 1.7 Å

PDB Description: phenylalanine zipper mediates aps dimerization
PDB Compounds: (A:) adaptor protein with pleckstrin homology and src homology 2 domains

SCOPe Domain Sequences for d1q2ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2ha_ a.34.4.1 (A:) Adapter protein APS, dimerisation domain {Human (Homo sapiens) [TaxId: 9606]}
pdwrqfcelhaqaaavdfahkfcrflrdnpaydtpdagasfsrhfaanfldvfgeevrrv
lva

SCOPe Domain Coordinates for d1q2ha_:

Click to download the PDB-style file with coordinates for d1q2ha_.
(The format of our PDB-style files is described here.)

Timeline for d1q2ha_: