Lineage for d1q2da_ (1q2d A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2574995Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2575033Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (3 species)
  7. 2575039Species Tetrahymena thermophila [TaxId:5911] [55739] (9 PDB entries)
    Uniprot Q27198 49-209
  8. 2575046Domain d1q2da_: 1q2d A: [104497]
    complexed with coa

Details for d1q2da_

PDB Entry: 1q2d (more details), 2.25 Å

PDB Description: Crystal Structure of Tetrahymena GCN5 With Bound Coenzyme A and a 19-residue p53 peptide
PDB Compounds: (A:) histone acetyltransferase gcn5

SCOPe Domain Sequences for d1q2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2da_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]}
ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdyg

SCOPe Domain Coordinates for d1q2da_:

Click to download the PDB-style file with coordinates for d1q2da_.
(The format of our PDB-style files is described here.)

Timeline for d1q2da_: