Lineage for d1q2ca1 (1q2c A:49-209)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (3 species)
  7. Species Tetrahymena thermophila [TaxId:5911] [55739] (9 PDB entries)
    Uniprot Q27198 49-209
  8. Domain d1q2ca1: 1q2c A:49-209 [104496]
    Other proteins in same PDB: d1q2ca2
    complexed with coa

Details for d1q2ca1

PDB Entry: 1q2c (more details), 2.25 Å

PDB Description: Crystal Structure of Tetrahymena GCN5 With Bound Coenzyme A and a 19-residue Histone H4 Peptide
PDB Compounds: (A:) histone acetyltransferase gcn5

SCOPe Domain Sequences for d1q2ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q2ca1 d.108.1.1 (A:49-209) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]}
ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdyg

SCOPe Domain Coordinates for d1q2ca1 are not available.

Timeline for d1q2ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q2ca2