Lineage for d1q25a2 (1q25 A:130-280)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074396Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 2074397Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 2074398Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. 2074427Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species)
  7. 2074430Species Cow (Bos taurus) [TaxId:9913] [110283] (5 PDB entries)
    Uniprot P08169 49-476
  8. 2074432Domain d1q25a2: 1q25 A:130-280 [104494]
    complexed with gol

Details for d1q25a2

PDB Entry: 1q25 (more details), 1.8 Å

PDB Description: crystal structure of n-terminal 3 domains of ci-mpr
PDB Compounds: (A:) Cation-Independent Mannose 6-phosphate receptor

SCOPe Domain Sequences for d1q25a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q25a2 b.64.1.1 (A:130-280) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]}
ankevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievlrasspqvrv
cptgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkegagqpdfcdghspavtitfv
cpserregtipkltaksncrfeiewvteyac

SCOPe Domain Coordinates for d1q25a2:

Click to download the PDB-style file with coordinates for d1q25a2.
(The format of our PDB-style files is described here.)

Timeline for d1q25a2: