Lineage for d1q23g_ (1q23 G:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486085Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 486086Superfamily c.43.1: CoA-dependent acyltransferases [52777] (3 families) (S)
  5. 486087Family c.43.1.1: CAT-like [52778] (3 proteins)
    trimeric enzymes with the active sites being located in between subunits
  6. 486088Protein Chloramphenicol acetyltransferase, CAT [52779] (2 species)
  7. 486089Species Escherichia coli [TaxId:562] [52780] (8 PDB entries)
  8. 486101Domain d1q23g_: 1q23 G: [104487]

Details for d1q23g_

PDB Entry: 1q23 (more details), 2.18 Å

PDB Description: Crystal structure of Chloramphenicol acetyltransferase I complexed with Fusidic acid at 2.18 A resolution

SCOP Domain Sequences for d1q23g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q23g_ c.43.1.1 (G:) Chloramphenicol acetyltransferase, CAT {Escherichia coli}
tgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafihilar
lmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiysqdva
cygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgdkvlm
plaiqvhhavcdgfhvgrmlnelqqycdewqgg

SCOP Domain Coordinates for d1q23g_:

Click to download the PDB-style file with coordinates for d1q23g_.
(The format of our PDB-style files is described here.)

Timeline for d1q23g_: