Lineage for d1q1va1 (1q1v A:309-375)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013855Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 2013897Superfamily a.159.4: DEK C-terminal domain [109715] (1 family) (S)
    automatically mapped to Pfam PF08766
  5. 2013898Family a.159.4.1: DEK C-terminal domain [109716] (1 protein)
  6. 2013899Protein DEK C-terminal domain [109717] (1 species)
  7. 2013900Species Human (Homo sapiens) [TaxId:9606] [109718] (1 PDB entry)
    Uniprot P35659 309-375
  8. 2013901Domain d1q1va1: 1q1v A:309-375 [104479]
    Other proteins in same PDB: d1q1va2

Details for d1q1va1

PDB Entry: 1q1v (more details)

PDB Description: Structure of the Oncoprotein DEK: a putative DNA-binding Domain Related to the Winged Helix Motif
PDB Compounds: (A:) DEK protein

SCOPe Domain Sequences for d1q1va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1va1 a.159.4.1 (A:309-375) DEK C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
deplikklkkpptdeelketikkllasanleevtmkqickkvyenyptydlterkdfikt
tvkelis

SCOPe Domain Coordinates for d1q1va1:

Click to download the PDB-style file with coordinates for d1q1va1.
(The format of our PDB-style files is described here.)

Timeline for d1q1va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q1va2