| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
| Protein Cinnamyl alcohol dehydrogenase, ADH6 [110403] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110404] (3 PDB entries) Uniprot Q04894 |
| Domain d1q1na2: 1q1n A:153-320 [104478] Other proteins in same PDB: d1q1na1 complexed with zn |
PDB Entry: 1q1n (more details), 3.15 Å
SCOPe Domain Sequences for d1q1na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1na2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ipshlaapllcggltvysplvrngcgpgkkvgivglggigsmgtliskamgaetyvisrs
srkredamkmgadhyiatleegdwgekyfdtfdlivvcassltdidfnimpkamkvggri
vsisipeqhemlslkpyglkavsisysalgsikelnqllklvsekdik
Timeline for d1q1na2: