Lineage for d1q1na1 (1q1n A:1-152,A:321-360)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461906Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 461907Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 461986Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (13 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 462190Protein Cinnamyl alcohol dehydrogenase, ADH6 [110173] (1 species)
  7. 462191Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110174] (3 PDB entries)
  8. 462192Domain d1q1na1: 1q1n A:1-152,A:321-360 [104477]
    Other proteins in same PDB: d1q1na2

Details for d1q1na1

PDB Entry: 1q1n (more details), 3.15 Å

PDB Description: apo and holo structures of an nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae

SCOP Domain Sequences for d1q1na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1na1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae)}
msypekfegiaiqshedwknpkktkydpkpfydhdidikieacgvcgsdihcaaghwgnm
kmplvvgheivgkvvklgpksnsglkvgqrvgvgaqvfsclecdrckndnepyctkfvtt
ysqpyedgyvsqggyanyvrvhehfvvpipenXiwvetlpvgeagvheafermekgdvry
rftlvgydkefsd

SCOP Domain Coordinates for d1q1na1:

Click to download the PDB-style file with coordinates for d1q1na1.
(The format of our PDB-style files is described here.)

Timeline for d1q1na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q1na2