| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Neuroglobin [100978] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [109625] (12 PDB entries) Uniprot Q9ER97 |
| Domain d1q1fa_: 1q1f A: [104476] complexed with hem |
PDB Entry: 1q1f (more details), 1.5 Å
SCOPe Domain Sequences for d1q1fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg
Timeline for d1q1fa_: