Lineage for d1q1ca2 (1q1c A:141-257)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720426Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 720427Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 720515Protein FKBP52, N-terminal domains [82619] (1 species)
  7. 720516Species Human (Homo sapiens) [TaxId:9606] [82620] (4 PDB entries)
  8. 720518Domain d1q1ca2: 1q1c A:141-257 [104475]
    complexed with dms, edo

Details for d1q1ca2

PDB Entry: 1q1c (more details), 1.9 Å

PDB Description: Crystal structure of N(1-260) of human FKBP52
PDB Compounds: (A:) FK506-binding protein 4

SCOP Domain Sequences for d1q1ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
dlteeedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldl
pygleraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekake

SCOP Domain Coordinates for d1q1ca2:

Click to download the PDB-style file with coordinates for d1q1ca2.
(The format of our PDB-style files is described here.)

Timeline for d1q1ca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q1ca1