Lineage for d1q1ca2 (1q1c A:141-257)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheet
Superfamily d.26.1: FKBP-like [54534] (3 families) 
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins) 
Protein FKBP52, N-terminal domain [82619] (1 species) Species Human (Homo sapiens) [TaxId:9606] [82620] (4 PDB entries) 
Domain d1q1ca2: 1q1c A:141-257 [104475]
tandem repeat of two FKPB domain
Details for d1q1ca2
PDB Entry: 1q1c (more details), 1.9 Å
PDB Description: Crystal structure of N(1-260) of human FKBP52
SCOP Domain Sequences for d1q1ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domain {Human (Homo sapiens)}
dlteeedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldl
pygleraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekake
SCOP Domain Coordinates for d1q1ca2:
Click to download the PDB-style file with coordinates for d1q1ca2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1q1ca2:
- d1q1ca2 is new in SCOP 1.69
- d1q1ca2 appears in SCOP 1.71
- d1q1ca2 appears in the current release, SCOPe 2.08
View in 3D
