Lineage for d1q18b2 (1q18 B:112-321)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586265Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families) (S)
    duplication contains two domains of this fold
  5. 586577Family c.55.1.7: Glucokinase [110627] (1 protein)
    Pfam 02685
  6. 586578Protein Glucokinase Glk [110628] (1 species)
  7. 586579Species Escherichia coli [TaxId:562] [110629] (2 PDB entries)
  8. 586585Domain d1q18b2: 1q18 B:112-321 [104473]

Details for d1q18b2

PDB Entry: 1q18 (more details), 2.36 Å

PDB Description: Crystal structure of E.coli glucokinase (Glk)

SCOP Domain Sequences for d1q18b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q18b2 c.55.1.7 (B:112-321) Glucokinase Glk {Escherichia coli}
kkehliqfggaepvegkpiavygagtglgvahlvhvdkrwvslpgegghvdfapnseeea
iileilraeighvsaervlsgpglvnlyraivkadnrlpenlkpkditeraladsctdcr
ralslfcvimgrfggnlalnlgtfggvfiaggivprfleffkasgfraafedkgrfkeyv
hdipvylivhdnpgllgsgahlrqtlghil

SCOP Domain Coordinates for d1q18b2:

Click to download the PDB-style file with coordinates for d1q18b2.
(The format of our PDB-style files is described here.)

Timeline for d1q18b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q18b1