SCOPe 2.08: Domain d1q18b2: 1q18 B:112-321

Lineage for d1q18b2 (1q18 B:112-321)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.7: Glucokinase [110627] (2 proteins)
   Pfam PF02685

6. Protein Glucokinase Glk, C-terminal domain [418997] (1 species)

7. Species Escherichia coli [TaxId:562] [419469] (2 PDB entries)
   Uniprot P0A6V8

8. Domain d1q18b2: 1q18 B:112-321 [104473]
   Other proteins in same PDB: d1q18a1, d1q18b1
   has additional insertions and/or extensions that are not grouped together

Details for d1q18b2

PDB Entry: 1q18, 2.36 Å

PDB Description: Crystal structure of E.coli glucokinase (Glk)

PDB Compounds: (B:) Glucokinase

SCOPe Domain Sequences for d1q18b2:

Sequence; same for both SEQRES and ATOM records:

>d1q18b2 c.55.1.7 (B:112-321) Glucokinase Glk, C-terminal domain {Escherichia coli [TaxId: 562]}
kkehliqfggaepvegkpiavygagtglgvahlvhvdkrwvslpgegghvdfapnseeea
iileilraeighvsaervlsgpglvnlyraivkadnrlpenlkpkditeraladsctdcr
ralslfcvimgrfggnlalnlgtfggvfiaggivprfleffkasgfraafedkgrfkeyv
hdipvylivhdnpgllgsgahlrqtlghil

Timeline for d1q18b2:

• d1q18b2 first appeared in SCOP 1.69
  
• d1q18b2 appears in SCOPe 2.07