Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.7: Glucokinase [110627] (1 protein) Pfam PF02685 |
Protein Glucokinase Glk [110628] (1 species) |
Species Escherichia coli [TaxId:562] [110629] (2 PDB entries) Uniprot P46880 P0A6V8 |
Domain d1q18b1: 1q18 B:2-111 [104472] |
PDB Entry: 1q18 (more details), 2.36 Å
SCOPe Domain Sequences for d1q18b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q18b1 c.55.1.7 (B:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} tkyalvgdvggtnarlalcdiasgeisqaktysgldypsleavirvyleehkvevkdgci aiacpitgdwvamtnhtwafsiaemkknlgfshleiindftavsmaipml
Timeline for d1q18b1: