Lineage for d1q18b1 (1q18 B:2-111)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488063Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) (S)
    duplication contains two domains of this fold
  5. 488356Family c.55.1.7: Glucokinase (Pfam 02685) [110627] (1 protein)
  6. 488357Protein Glucokinase Glk [110628] (1 species)
  7. 488358Species Escherichia coli [TaxId:562] [110629] (1 PDB entry)
  8. 488361Domain d1q18b1: 1q18 B:2-111 [104472]

Details for d1q18b1

PDB Entry: 1q18 (more details), 2.36 Å

PDB Description: Crystal structure of E.coli glucokinase (Glk)

SCOP Domain Sequences for d1q18b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q18b1 c.55.1.7 (B:2-111) Glucokinase Glk {Escherichia coli}
tkyalvgdvggtnarlalcdiasgeisqaktysgldypsleavirvyleehkvevkdgci
aiacpitgdwvamtnhtwafsiaemkknlgfshleiindftavsmaipml

SCOP Domain Coordinates for d1q18b1:

Click to download the PDB-style file with coordinates for d1q18b1.
(The format of our PDB-style files is described here.)

Timeline for d1q18b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q18b2