Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) duplication contains two domains of this fold |
Family c.55.1.7: Glucokinase (Pfam 02685) [110627] (1 protein) |
Protein Glucokinase Glk [110628] (1 species) |
Species Escherichia coli [TaxId:562] [110629] (1 PDB entry) |
Domain d1q18a2: 1q18 A:112-321 [104471] |
PDB Entry: 1q18 (more details), 2.36 Å
SCOP Domain Sequences for d1q18a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q18a2 c.55.1.7 (A:112-321) Glucokinase Glk {Escherichia coli} kkehliqfggaepvegkpiavygagtglgvahlvhvdkrwvslpgegghvdfapnseeea iileilraeighvsaervlsgpglvnlyraivkadnrlpenlkpkditeraladsctdcr ralslfcvimgrfggnlalnlgtfggvfiaggivprfleffkasgfraafedkgrfkeyv hdipvylivhdnpgllgsgahlrqtlghil
Timeline for d1q18a2: