Lineage for d1q18a2 (1q18 A:112-321)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884529Family c.55.1.7: Glucokinase [110627] (2 proteins)
    Pfam PF02685
  6. 2884530Protein Glucokinase Glk, C-terminal domain [418997] (1 species)
  7. 2884531Species Escherichia coli [TaxId:562] [419469] (2 PDB entries)
    Uniprot P0A6V8
  8. 2884532Domain d1q18a2: 1q18 A:112-321 [104471]
    Other proteins in same PDB: d1q18a1, d1q18b1
    has additional insertions and/or extensions that are not grouped together

Details for d1q18a2

PDB Entry: 1q18 (more details), 2.36 Å

PDB Description: Crystal structure of E.coli glucokinase (Glk)
PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d1q18a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q18a2 c.55.1.7 (A:112-321) Glucokinase Glk, C-terminal domain {Escherichia coli [TaxId: 562]}
kkehliqfggaepvegkpiavygagtglgvahlvhvdkrwvslpgegghvdfapnseeea
iileilraeighvsaervlsgpglvnlyraivkadnrlpenlkpkditeraladsctdcr
ralslfcvimgrfggnlalnlgtfggvfiaggivprfleffkasgfraafedkgrfkeyv
hdipvylivhdnpgllgsgahlrqtlghil

SCOPe Domain Coordinates for d1q18a2:

Click to download the PDB-style file with coordinates for d1q18a2.
(The format of our PDB-style files is described here.)

Timeline for d1q18a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q18a1