SCOP 1.69: Domain d1q18a1: 1q18 A:2-111

Lineage for d1q18a1 (1q18 A:2-111)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families)
   duplication contains two domains of this fold

5. Family c.55.1.7: Glucokinase (Pfam 02685) [110627] (1 protein)

6. Protein Glucokinase Glk [110628] (1 species)

7. Species Escherichia coli [TaxId:562] [110629] (1 PDB entry)

8. Domain d1q18a1: 1q18 A:2-111 [104470]

Details for d1q18a1

PDB Entry: 1q18, 2.36 Å

PDB Description: Crystal structure of E.coli glucokinase (Glk)

SCOP Domain Sequences for d1q18a1:

Sequence; same for both SEQRES and ATOM records:

>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli}
tkyalvgdvggtnarlalcdiasgeisqaktysgldypsleavirvyleehkvevkdgci
aiacpitgdwvamtnhtwafsiaemkknlgfshleiindftavsmaipml

Timeline for d1q18a1:

• d1q18a1 is new in SCOP 1.69
  
• d1q18a1 appears in SCOP 1.71
  
• d1q18a1 appears in the current release, SCOPe 2.08