| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.7: Glucokinase [110627] (2 proteins) Pfam PF02685 |
| Protein Glucokinase Glk, N-terminal domain [418996] (1 species) |
| Species Escherichia coli [TaxId:562] [419468] (2 PDB entries) Uniprot P46880 |
| Domain d1q18a1: 1q18 A:2-111 [104470] Other proteins in same PDB: d1q18a2, d1q18b2 |
PDB Entry: 1q18 (more details), 2.36 Å
SCOPe Domain Sequences for d1q18a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk, N-terminal domain {Escherichia coli [TaxId: 562]}
tkyalvgdvggtnarlalcdiasgeisqaktysgldypsleavirvyleehkvevkdgci
aiacpitgdwvamtnhtwafsiaemkknlgfshleiindftavsmaipml
Timeline for d1q18a1: