SCOPe 2.05: Domain d1q0qa3: 1q0q A:126-274

Lineage for d1q0qa3 (1q0q A:126-274)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)

6. Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (2 species)

7. Species Escherichia coli [TaxId:562] [69771] (11 PDB entries)
   Uniprot P45568

8. Domain d1q0qa3: 1q0q A:126-274 [104466]
   Other proteins in same PDB: d1q0qa1, d1q0qa2, d1q0qb1, d1q0qb2
   complexed with dxp, ndp

Details for d1q0qa3

PDB Entry: 1q0q, 1.9 Å

PDB Description: crystal structure of dxr in complex with the substrate 1-deoxy-d- xylulose-5-phosphate

PDB Compounds: (A:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1q0qa3:

Sequence; same for both SEQRES and ATOM records:

>d1q0qa3 d.81.1.3 (A:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
eslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltg
sggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasq
mevlihpqsvihsmvryqdgsvlaqlgep

Timeline for d1q0qa3:

• d1q0qa3 first appeared in SCOP 1.69
  
• d1q0qa3 appears in SCOPe 2.04
  
• d1q0qa3 appears in SCOPe 2.06
  
• d1q0qa3 appears in the current release, SCOPe 2.08