SCOP 1.69: Domain d1q0qa1: 1q0q A:301-398

Lineage for d1q0qa1 (1q0q A:301-398)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family)

5. Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein)

6. Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (2 species)

7. Species Escherichia coli [TaxId:562] [69058] (10 PDB entries)

8. Domain d1q0qa1: 1q0q A:301-398 [104464]
   Other proteins in same PDB: d1q0qa2, d1q0qa3, d1q0qb2, d1q0qb3

Details for d1q0qa1

PDB Entry: 1q0q, 1.9 Å

PDB Description: crystal structure of dxr in complex with the substrate 1-deoxy-d- xylulose-5-phosphate

SCOP Domain Sequences for d1q0qa1:

Sequence; same for both SEQRES and ATOM records:

>d1q0qa1 a.69.3.1 (A:301-398) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli}
klsaltfaapdydrypclklameafeqgqaattalnaaneitvaaflaqqirftdiaaln
lsvlekmdmrepqcvddvlsvdanarevarkevmrlas

Timeline for d1q0qa1:

• d1q0qa1 is new in SCOP 1.69
  
• d1q0qa1 appears in SCOP 1.71
  
• d1q0qa1 appears in the current release, SCOPe 2.08